Lineage for d1hz4a_ (1hz4 A:)

  1. Root: SCOP 1.59
  2. 93448Class a: All alpha proteins [46456] (151 folds)
  3. 100538Fold a.118: alpha-alpha superhelix [48370] (13 superfamilies)
  4. 100761Superfamily a.118.8: TPR-like [48452] (2 families) (S)
  5. 100788Family a.118.8.2: Transcription factor MalT domain III [69094] (1 protein)
  6. 100789Protein Transcription factor MalT domain III [69095] (1 species)
  7. 100790Species Escherichia coli [TaxId:562] [69096] (1 PDB entry)
  8. 100791Domain d1hz4a_: 1hz4 A: [65960]

Details for d1hz4a_

PDB Entry: 1hz4 (more details), 1.45 Å

PDB Description: crystal structure of transcription factor malt domain iii

SCOP Domain Sequences for d1hz4a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli}
eikdiredtmhaefnalraqvaindgnpdeaerlaklaleelppgwfysrivatsvlgev
lhckgeltrslalmqqteqmarqhdvwhyalwsliqqseilfaqgflqtawetqekafql
ineqhleqlpmheflvriraqllwawarldeaeasarsgievlssyqpqqqlqclamliq
cslargdldnarsqlnrlenllgngkyhsdwisnankvrviywqmtgdkaaaanwlrhta
kpefannhflqgqwrniaraqillgefepaeivleelnenarslrlmsdlnrnllllnql
ywqagrksdaqrvlldalklanrtgfishfviegeamaqqlrqliqlntlpeleqhraqr
ilrein

SCOP Domain Coordinates for d1hz4a_:

Click to download the PDB-style file with coordinates for d1hz4a_.
(The format of our PDB-style files is described here.)

Timeline for d1hz4a_: