Lineage for d1hxka_ (1hxk A:)

  1. Root: SCOP 1.63
  2. 266016Class e: Multi-domain proteins (alpha and beta) [56572] (39 folds)
  3. 267356Fold e.33: Golgi alpha-mannosidase II [69897] (1 superfamily)
    3 domains: (1) a distorted beta/alpha barrel, (2) three-helical bundle; (3) all-beta elaborated supersandwich fold
  4. 267357Superfamily e.33.1: Golgi alpha-mannosidase II [69898] (1 family) (S)
  5. 267358Family e.33.1.1: Golgi alpha-mannosidase II [69899] (1 protein)
  6. 267359Protein Golgi alpha-mannosidase II [69900] (1 species)
  7. 267360Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [69901] (3 PDB entries)
  8. 267362Domain d1hxka_: 1hxk A: [65951]
    complexed with ddm, mpd, nag, zn

Details for d1hxka_

PDB Entry: 1hxk (more details), 1.5 Å

PDB Description: golgi alpha-mannosidase ii in complex with deoxymannojirimicin

SCOP Domain Sequences for d1hxka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hxka_ e.33.1.1 (A:) Golgi alpha-mannosidase II {Fruit fly (Drosophila melanogaster)}
cqdvvqdvpnvdvqmlelydrmsfkdidggvwkqgwnikydplkynahhklkvfvvphsh
ndpgwiqtfeeyyqhdtkhilsnalrhlhdnpemkfiwaeisyfarfyhdlgenkklqmk
sivkngqlefvtggwvmpdeanshwrnvllqltegqtwlkqfmnvtptaswaidpfghsp
tmpyilqksgfknmliqrthysvkkelaqqrqleflwrqiwdnkgdtalfthmmpfysyd
iphtcgpdpkvccqfdfkrmgsfglscpwkvpprtisdqnvaarsdllvdqwkkkaelyr
tnvlliplgddfrfkqntewdvqrvnyerlfehinsqahfnvqaqfgtlqeyfdavhqae
ragqaefptlsgdfftyadrsdnywsgyytsrpyhkrmdrvlmhyvraaemlsawhswdg
marieerleqarrelslfqhhdgitgtakthvvvdyeqrmqealkacqmvmqqsvyrllt
kpsiyspdfsfsyftlddsrwpgsgvedsrttiilgedilpskhvvmhntlphwreqlvd
fyvsspfvsvtdlannpveaqvspvwswhhdtltktihpqgsttkyriifkarvppmgla
tyvltisdskpehtsyasnlllrknptslplgqypedvkfgdpreislrvgngptlafse
qgllksiqltqdsphvpvhfkflkygvrshgdrsgaylflpngpaspvelgqpvvlvtkg
klessvsvglpsvvhqtimrggapeirnlvdigsldnteivmrlethidsgdifytdlng
lqfikrrrldklplqanyypipsgmfiedantrltlltgqplggsslasgeleimqdrrl
asdderglgqgvldnkpvlhiyrlvlekvnncvrpsklhpagyltsaahkasqslldpld
kfifaenewigaqgqfggdhpsaredldvsvmrrltkssaktqrvgyvlhrtnlmqcgtp
eehtqkldvchllpnvarcerttltflqnlehldgmvapevcpmetaayvsshs

SCOP Domain Coordinates for d1hxka_:

Click to download the PDB-style file with coordinates for d1hxka_.
(The format of our PDB-style files is described here.)

Timeline for d1hxka_: