Lineage for d1ht1z_ (1ht1 Z:)

  1. Root: SCOP 1.61
  2. 187024Class d: Alpha and beta proteins (a+b) [53931] (212 folds)
  3. 197693Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
  4. 197694Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (5 families) (S)
  5. 197799Family d.153.1.4: Proteasome subunits [56251] (3 proteins)
  6. 197800Protein HslV (ClpQ) protease [56258] (2 species)
  7. 197801Species Escherichia coli [TaxId:562] [56259] (7 PDB entries)
  8. 197809Domain d1ht1z_: 1ht1 Z: [65935]
    Other proteins in same PDB: d1ht1e_, d1ht1f_, d1ht1g_, d1ht1i_

Details for d1ht1z_

PDB Entry: 1ht1 (more details), 2.8 Å

PDB Description: nucleotide-dependent conformational changes in a protease-associated atpase hslu

SCOP Domain Sequences for d1ht1z_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ht1z_ d.153.1.4 (Z:) HslV (ClpQ) protease {Escherichia coli}
ttivsvrrnghvviagdgqatlgntvmkgnvkkvrrlyndkviagfaggtadaftlfelf
erklemhqghlvkaavelakdwrtdrmlrkleallavadetasliitgngdvvqpendli
aigsggpyaqaaarallentelsareiaekaldiagdiciytnhfhtieelsyk

SCOP Domain Coordinates for d1ht1z_:

Click to download the PDB-style file with coordinates for d1ht1z_.
(The format of our PDB-style files is described here.)

Timeline for d1ht1z_: