SCOP 1.61: Domain d1hqyd_: 1hqy D:

Lineage for d1hqyd_ (1hqy D:)

1. Root: SCOP 1.61

2. Class d: Alpha and beta proteins (a+b) [53931] (212 folds)

3. Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)

4. Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (5 families)

5. Family d.153.1.4: Proteasome subunits [56251] (3 proteins)

6. Protein HslV (ClpQ) protease [56258] (2 species)

7. Species Escherichia coli [TaxId:562] [56259] (7 PDB entries)

8. Domain d1hqyd_: 1hqy D: [65912]
   Other proteins in same PDB: d1hqye_, d1hqyf_

Details for d1hqyd_

PDB Entry: 1hqy, 2.8 Å

PDB Description: nucleotide-dependent conformational changes in a protease-associated atpase hslu

SCOP Domain Sequences for d1hqyd_:

Sequence; same for both SEQRES and ATOM records:

>d1hqyd_ d.153.1.4 (D:) HslV (ClpQ) protease {Escherichia coli}
ttivsvrrnghvviagdgqatlgntvmkgnvkkvrrlyndkviagfaggtadaftlfelf
erklemhqghlvkaavelakdwrtdrmlrkleallavadetasliitgngdvvqpendli
aigsggpyaqaaarallentelsareiaekaldiagdiciytnhfhtieelsyk

Timeline for d1hqyd_:

• d1hqyd_ first appeared in SCOP 1.59
  
• d1hqyd_ appears in SCOP 1.63
  
• d1hqyd_ appears in the current release, SCOPe 2.08