SCOP 1.75: Domain d1hqyc_: 1hqy C:

Lineage for d1hqyc_ (1hqy C:)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
   4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing

4. Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (7 families)
   N-terminal residue provides two catalytic groups, nucleophile and proton donor

5. Family d.153.1.4: Proteasome subunits [56251] (3 proteins)

6. Protein HslV (ClpQ) protease [56258] (4 species)
   dodecameric prokaryotic homologue of proteasome

7. Species Escherichia coli [TaxId:562] [56259] (7 PDB entries)

8. Domain d1hqyc_: 1hqy C: [65911]
   Other proteins in same PDB: d1hqye_, d1hqyf_

Details for d1hqyc_

PDB Entry: 1hqy, 2.8 Å

PDB Description: nucleotide-dependent conformational changes in a protease-associated atpase hslu

PDB Compounds: (C:) heat shock locus hslv

SCOP Domain Sequences for d1hqyc_:

Sequence; same for both SEQRES and ATOM records:

>d1hqyc_ d.153.1.4 (C:) HslV (ClpQ) protease {Escherichia coli [TaxId: 562]}
ttivsvrrnghvviagdgqatlgntvmkgnvkkvrrlyndkviagfaggtadaftlfelf
erklemhqghlvkaavelakdwrtdrmlrkleallavadetasliitgngdvvqpendli
aigsggpyaqaaarallentelsareiaekaldiagdiciytnhfhtieelsyk

Timeline for d1hqyc_:

• d1hqyc_ first appeared in SCOP 1.59
  
• d1hqyc_ appears in SCOP 1.73
  
• d1hqyc_ appears in SCOPe 2.01
  
• d1hqyc_ appears in the current release, SCOPe 2.08