Lineage for d1hova_ (1hov A:)

  1. Root: SCOP 1.59
  2. 128814Class d: Alpha and beta proteins (a+b) [53931] (208 folds)
  3. 135687Fold d.92: Zincin-like [55485] (2 superfamilies)
  4. 135688Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (14 families) (S)
  5. 135817Family d.92.1.11: Matrix metalloproteases, catalytic domain [55528] (10 proteins)
  6. 135863Protein MMP-2 [69778] (1 species)
  7. 135864Species Human (Homo sapiens) [TaxId:9606] [69779] (1 PDB entry)
  8. 135865Domain d1hova_: 1hov A: [65897]

Details for d1hova_

PDB Entry: 1hov (more details)

PDB Description: solution structure of a catalytic domain of mmp-2 complexed with sc-74020

SCOP Domain Sequences for d1hova_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hova_ d.92.1.11 (A:) MMP-2 {Human (Homo sapiens)}
mynffprkpkwdknqityriigytpdldpetvddafarafqvwsdvtplrfsrihdgead
iminfgrwehgdgypfdgkdgllahafapgtgvggdshfdddelwtntsanyslflvaah
efghamglehsqdpgalmapiytytknfrlsqddikgiqelyg

SCOP Domain Coordinates for d1hova_:

Click to download the PDB-style file with coordinates for d1hova_.
(The format of our PDB-style files is described here.)

Timeline for d1hova_: