Lineage for d1hn3a1 (1hn3 A:4-40)

  1. Root: SCOPe 2.06
  2. 2271421Class j: Peptides [58231] (133 folds)
  3. 2273017Fold j.91: Tumor suppressor protein p19-ARF fragment [70042] (1 superfamily)
  4. 2273018Superfamily j.91.1: Tumor suppressor protein p19-ARF fragment [70043] (1 family) (S)
  5. 2273019Family j.91.1.1: Tumor suppressor protein p19-ARF fragment [70044] (1 protein)
  6. 2273020Protein Tumor suppressor protein p19-ARF fragment [70045] (1 species)
  7. 2273021Species Mouse (Mus musculus) [TaxId:10090] [70046] (1 PDB entry)
  8. 2273022Domain d1hn3a1: 1hn3 A:4-40 [65892]
    Other proteins in same PDB: d1hn3a2

Details for d1hn3a1

PDB Entry: 1hn3 (more details)

PDB Description: solution structure of the n-terminal 37 amino acids of the mouse arf tumor suppressor protein
PDB Compounds: (A:) p19 arf protein

SCOPe Domain Sequences for d1hn3a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hn3a1 j.91.1.1 (A:4-40) Tumor suppressor protein p19-ARF fragment {Mouse (Mus musculus) [TaxId: 10090]}
mgrrflvtvriqragrplqervflvkfvrsrrprtas

SCOPe Domain Coordinates for d1hn3a1:

Click to download the PDB-style file with coordinates for d1hn3a1.
(The format of our PDB-style files is described here.)

Timeline for d1hn3a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1hn3a2