Lineage for d1hn1d5 (1hn1 D:334-625)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1565956Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1568602Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 1569213Family c.1.8.3: beta-glycanases [51487] (27 proteins)
    consist of a number of sequence families
  6. 1569297Protein beta-Galactosidase, domain 3 [51510] (2 species)
  7. 1569305Species Escherichia coli [TaxId:562] [51511] (41 PDB entries)
    Uniprot P00722
  8. 1569469Domain d1hn1d5: 1hn1 D:334-625 [65889]
    Other proteins in same PDB: d1hn1a1, d1hn1a2, d1hn1a3, d1hn1a4, d1hn1b1, d1hn1b2, d1hn1b3, d1hn1b4, d1hn1c1, d1hn1c2, d1hn1c3, d1hn1c4, d1hn1d1, d1hn1d2, d1hn1d3, d1hn1d4
    complexed with mg, na

Details for d1hn1d5

PDB Entry: 1hn1 (more details), 3 Å

PDB Description: e. coli (lac z) beta-galactosidase (orthorhombic)
PDB Compounds: (D:) beta-galactosidase

SCOPe Domain Sequences for d1hn1d5:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hn1d5 c.1.8.3 (D:334-625) beta-Galactosidase, domain 3 {Escherichia coli [TaxId: 562]}
evriengllllngkpllirgvnrhehhplhgqvmdeqtmvqdillmkqnnfnavrcshyp
nhplwytlcdryglyvvdeaniethgmvpmnrltddprwlpamservtrmvqrdrnhpsv
iiwslgnesghganhdalyrwiksvdpsrpvqyegggadttatdiicpmyarvdedqpfp
avpkwsikkwlslpgetrplilceyahamgnslggfakywqafrqyprlqggfvwdwvdq
slikydengnpwsayggdfgdtpndrqfcmnglvfadrtphpalteakhqqq

SCOPe Domain Coordinates for d1hn1d5:

Click to download the PDB-style file with coordinates for d1hn1d5.
(The format of our PDB-style files is described here.)

Timeline for d1hn1d5: