Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) |
Family c.1.8.3: beta-glycanases [51487] (27 proteins) consist of a number of sequence families |
Protein beta-Galactosidase, domain 3 [51510] (2 species) |
Species Escherichia coli [TaxId:562] [51511] (41 PDB entries) Uniprot P00722 |
Domain d1hn1b5: 1hn1 B:334-625 [65879] Other proteins in same PDB: d1hn1a1, d1hn1a2, d1hn1a3, d1hn1a4, d1hn1b1, d1hn1b2, d1hn1b3, d1hn1b4, d1hn1c1, d1hn1c2, d1hn1c3, d1hn1c4, d1hn1d1, d1hn1d2, d1hn1d3, d1hn1d4 complexed with mg, na |
PDB Entry: 1hn1 (more details), 3 Å
SCOPe Domain Sequences for d1hn1b5:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hn1b5 c.1.8.3 (B:334-625) beta-Galactosidase, domain 3 {Escherichia coli [TaxId: 562]} evriengllllngkpllirgvnrhehhplhgqvmdeqtmvqdillmkqnnfnavrcshyp nhplwytlcdryglyvvdeaniethgmvpmnrltddprwlpamservtrmvqrdrnhpsv iiwslgnesghganhdalyrwiksvdpsrpvqyegggadttatdiicpmyarvdedqpfp avpkwsikkwlslpgetrplilceyahamgnslggfakywqafrqyprlqggfvwdwvdq slikydengnpwsayggdfgdtpndrqfcmnglvfadrtphpalteakhqqq
Timeline for d1hn1b5:
View in 3D Domains from same chain: (mouse over for more information) d1hn1b1, d1hn1b2, d1hn1b3, d1hn1b4 |