SCOPe 2.05: Domain d1hn1a1: 1hn1 A:220-333

Lineage for d1hn1a1 (1hn1 A:220-333)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.4: beta-Galactosidase/glucuronidase domain [49303] (2 families)

5. Family b.1.4.1: beta-Galactosidase/glucuronidase domain [49304] (4 proteins)

6. Protein beta-Galactosidase, domains 2 and 4 [49305] (2 species)

7. Species Escherichia coli [TaxId:562] [49306] (42 PDB entries)
   Uniprot P00722

8. Domain d1hn1a1: 1hn1 A:220-333 [65870]
   Other proteins in same PDB: d1hn1a3, d1hn1a4, d1hn1a5, d1hn1b3, d1hn1b4, d1hn1b5, d1hn1c3, d1hn1c4, d1hn1c5, d1hn1d3, d1hn1d4, d1hn1d5
   complexed with mg, na

Details for d1hn1a1

PDB Entry: 1hn1, 3 Å

PDB Description: e. coli (lac z) beta-galactosidase (orthorhombic)

PDB Compounds: (A:) beta-galactosidase

SCOPe Domain Sequences for d1hn1a1:

Sequence; same for both SEQRES and ATOM records:

>d1hn1a1 b.1.4.1 (A:220-333) beta-Galactosidase, domains 2 and 4 {Escherichia coli [TaxId: 562]}
tqisdfhvatrfnddfsravleaevqmcgelrdylrvtvslwqgetqvasgtapfggeii
derggyadrvtlrlnvenpklwsaeipnlyravvelhtadgtlieaeacdvgfr

Timeline for d1hn1a1:

• d1hn1a1 first appeared in SCOP 1.59
  
• d1hn1a1 appears in SCOPe 2.04
  
• d1hn1a1 appears in SCOPe 2.06
  
• d1hn1a1 appears in the current release, SCOPe 2.08