Lineage for d1hlra4 (1hlr A:311-907)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 418654Fold d.133: Molybdenum cofactor-binding domain [56002] (1 superfamily)
    beta(2)-alpha-beta-alpha-beta; 2 layers: a/b; mixed sheet: order 1243: crossing loops
  4. 418655Superfamily d.133.1: Molybdenum cofactor-binding domain [56003] (1 family) (S)
    duplication: consists of 4 structural repeats arranged in 2 lobes
    contains one left-hand beta-alpha-beta unit per lobe
  5. 418656Family d.133.1.1: Molybdenum cofactor-binding domain [56004] (4 proteins)
  6. 418657Protein Aldehyde oxidoreductase [56005] (2 species)
  7. 418660Species Desulfovibrio gigas [TaxId:879] [56006] (1 PDB entry)
  8. 418661Domain d1hlra4: 1hlr A:311-907 [65853]
    Other proteins in same PDB: d1hlra1, d1hlra2, d1hlra3
    complexed with cl, fes, ipa, mg, pcd

Details for d1hlra4

PDB Entry: 1hlr (more details), 1.28 Å

PDB Description: structure refinement of the aldehyde oxidoreductase from desulfovibrio gigas at 1.28 a

SCOP Domain Sequences for d1hlra4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hlra4 d.133.1.1 (A:311-907) Aldehyde oxidoreductase {Desulfovibrio gigas}
msgpaaaaedaieihpgtpnvyfeqpivkgedtgpifasadvtvegdfyvgrqphmpiep
dvafaymgddgkcyihsksigvhlhlymiapgvglepdqlvlvanpmggtfgykfsptse
alvavaamatgrpvhlrynyqqqqqytgkrspwemnvkfaakkdgtllamesdwlvdhgp
ysefgdlltlrgaqfigagynipnirglgrtvatnhvwgsafrgygapqsmfaseclmdm
laeklgmdplelryknayrpgdtnptgqepevfslpdmidqlrpkyqaalekaqkestat
hkkgvgisigvygsgldgpdaseawaelnadgtitvhtawedhgqgadigcvgtahealr
pmgvapekikftwpntattpnsgpsggsreqvmtgnairvacenllkacekpgggyytyd
elkaadkptkitgnwtasgathcdavtglgkpfvvymygvfmaevtvdvatgqttvdgmt
lmadlgslcnqlatdgqiygglaqgiglalsedfedikkhatlvgagfpfikqipdkldi
vyvnhprpdgpfgasgvgelpltsphaaiinaiksatgvriyrlpaypekvlealka

SCOP Domain Coordinates for d1hlra4:

Click to download the PDB-style file with coordinates for d1hlra4.
(The format of our PDB-style files is described here.)

Timeline for d1hlra4: