Lineage for d1hlra1 (1hlr A:81-193)

  1. Root: SCOP 1.67
  2. 349259Class a: All alpha proteins [46456] (202 folds)
  3. 356706Fold a.56: CO dehydrogenase ISP C-domain like [47740] (1 superfamily)
    core: 4 helices, bundle
  4. 356707Superfamily a.56.1: CO dehydrogenase ISP C-domain like [47741] (1 family) (S)
    contains 2Fe-2S cluster
  5. 356708Family a.56.1.1: CO dehydrogenase ISP C-domain like [47742] (4 proteins)
  6. 356709Protein Aldehyde oxidoreductase, domain 2 [47743] (2 species)
  7. 356712Species Desulfovibrio gigas [TaxId:879] [47744] (1 PDB entry)
  8. 356713Domain d1hlra1: 1hlr A:81-193 [65850]
    Other proteins in same PDB: d1hlra2, d1hlra3, d1hlra4
    complexed with cl, fes, ipa, mg, pcd

Details for d1hlra1

PDB Entry: 1hlr (more details), 1.28 Å

PDB Description: structure refinement of the aldehyde oxidoreductase from desulfovibrio gigas at 1.28 a

SCOP Domain Sequences for d1hlra1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hlra1 a.56.1.1 (A:81-193) Aldehyde oxidoreductase, domain 2 {Desulfovibrio gigas}
qpenlhplqkawvlhggaqcgfcspgfivsakglldtnadpsredvrdwfqkhrnacrct
gykplvdavmdaaavingkkpetdlefkmpadgriwgskyprptavakvtgtl

SCOP Domain Coordinates for d1hlra1:

Click to download the PDB-style file with coordinates for d1hlra1.
(The format of our PDB-style files is described here.)

Timeline for d1hlra1: