SCOP 1.73: Domain d1hh2p4: 1hh2 P:1-126

Lineage for d1hh2p4 (1hh2 P:1-126)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.202: Transcription factor NusA, N-terminal domain [69704] (1 superfamily)
   alpha-beta(3)-alpha-beta-alpha; bifurcated coiled beta-sheet

4. Superfamily d.202.1: Transcription factor NusA, N-terminal domain [69705] (1 family)

5. Family d.202.1.1: Transcription factor NusA, N-terminal domain [69706] (1 protein)

6. Protein Transcription factor NusA, N-terminal domain [69707] (2 species)

7. Species Thermotoga maritima [TaxId:2336] [69708] (2 PDB entries)

8. Domain d1hh2p4: 1hh2 P:1-126 [65838]
   Other proteins in same PDB: d1hh2p1, d1hh2p2, d1hh2p3

Details for d1hh2p4

PDB Entry: 1hh2, 2.1 Å

PDB Description: crystal structure of nusa from thermotoga maritima

PDB Compounds: (P:) n utilization substance protein a

SCOP Domain Sequences for d1hh2p4:

Sequence; same for both SEQRES and ATOM records:

>d1hh2p4 d.202.1.1 (P:1-126) Transcription factor NusA, N-terminal domain {Thermotoga maritima [TaxId: 2336]}
mnigllealdqleeekgiskeevipilekalvsayrknfgnsknvevvidrntgnikvyq
llevveevedpatqisleeakkidplaevgsivkkelnvknfgriaaqtakqvliqrire
lekekq

Timeline for d1hh2p4:

• d1hh2p4 first appeared in SCOP 1.59
  
• d1hh2p4 appears in SCOP 1.71
  
• d1hh2p4 appears in SCOP 1.75
  
• d1hh2p4 appears in the current release, SCOPe 2.08