Lineage for d1hh2p3 (1hh2 P:277-344)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 411467Fold d.52: Alpha-lytic protease prodomain-like [54805] (7 superfamilies)
    core: alpha-beta(2)-(alpha)-beta; 2 layers: alpha/beta
  4. 411494Superfamily d.52.3: Prokaryotic type KH domain (KH-domain type II) [54814] (1 family) (S)
    Prokaryotic and eukaryotic domains share a KH-motif but have different topologies
  5. 411495Family d.52.3.1: Prokaryotic type KH domain (KH-domain type II) [54815] (4 proteins)
  6. 411520Protein Transcription factor NusA, C-terminal domains [69701] (2 species)
    duplication: tandem repeat of two type II KH-domains
  7. 411526Species Thermotoga maritima [TaxId:243274] [69702] (2 PDB entries)
  8. 411528Domain d1hh2p3: 1hh2 P:277-344 [65837]
    Other proteins in same PDB: d1hh2p1, d1hh2p4

Details for d1hh2p3

PDB Entry: 1hh2 (more details), 2.1 Å

PDB Description: crystal structure of nusa from thermotoga maritima

SCOP Domain Sequences for d1hh2p3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hh2p3 d.52.3.1 (P:277-344) Transcription factor NusA, C-terminal domains {Thermotoga maritima}
ddpkqlianalapatvieveildkenkaarvlvpptqlslaigkggqnarlaakltgwki
dikpimnl

SCOP Domain Coordinates for d1hh2p3:

Click to download the PDB-style file with coordinates for d1hh2p3.
(The format of our PDB-style files is described here.)

Timeline for d1hh2p3: