Lineage for d1hh2p1 (1hh2 P:127-198)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 110053Fold b.40: OB-fold [50198] (8 superfamilies)
  4. 110553Superfamily b.40.4: Nucleic acid-binding proteins [50249] (9 families) (S)
  5. 110688Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (13 proteins)
  6. 110769Protein S1 domain of NusA [69265] (2 species)
  7. 110773Species Thermotoga maritima [TaxId:243274] [69266] (1 PDB entry)
  8. 110774Domain d1hh2p1: 1hh2 P:127-198 [65835]
    Other proteins in same PDB: d1hh2p2, d1hh2p3, d1hh2p4

Details for d1hh2p1

PDB Entry: 1hh2 (more details), 2.1 Å

PDB Description: crystal structure of nusa from thermotoga maritima

SCOP Domain Sequences for d1hh2p1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hh2p1 b.40.4.5 (P:127-198) S1 domain of NusA {Thermotoga maritima}
fekyselkgtvttaevirvmgewadirigkletrlpkkewipgeeikagdlvkvyiidvv
kttkgpkilvsr

SCOP Domain Coordinates for d1hh2p1:

Click to download the PDB-style file with coordinates for d1hh2p1.
(The format of our PDB-style files is described here.)

Timeline for d1hh2p1: