SCOP 1.71: Domain d1hfua1: 1hfu A:1-131

Lineage for d1hfua1 (1hfu A:1-131)

1. Root: SCOP 1.71

2. Class b: All beta proteins [48724] (149 folds)

3. Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands

4. Superfamily b.6.1: Cupredoxins [49503] (6 families)
   contains copper-binding site

5. Family b.6.1.3: Multidomain cupredoxins [49550] (7 proteins)

6. Protein Laccase [49557] (5 species)
   consists of three domains of this fold

7. Species Inky cap fungus (Coprinus cinereus) [TaxId:5346] [49558] (2 PDB entries)

8. Domain d1hfua1: 1hfu A:1-131 [65827]

Details for d1hfua1

PDB Entry: 1hfu, 1.68 Å

PDB Description: type-2 cu-depleted laccase from coprinus cinereus at 1.68 a resolution

SCOP Domain Sequences for d1hfua1:

Sequence; same for both SEQRES and ATOM records:

>d1hfua1 b.6.1.3 (A:1-131) Laccase {Inky cap fungus (Coprinus cinereus)}
aivnsvdtmtltnanvspdgftragilvngvhgplirggkndnfelnvvndldnptmlrp
tsihwhglfqrgtnwadgadgvnqcpispghaflykftpaghagtfwyhshfgtqycdgl
rgpmviyddnd

Timeline for d1hfua1:

• d1hfua1 first appeared in SCOP 1.59
  
• d1hfua1 appears in SCOP 1.69
  
• d1hfua1 appears in SCOP 1.73
  
• d1hfua1 appears in the current release, SCOPe 2.08