Class a: All alpha proteins [46456] (289 folds) |
Fold a.61: Retroviral matrix proteins [47835] (1 superfamily) 4-5 helices; right-handed superhelix |
Superfamily a.61.1: Retroviral matrix proteins [47836] (6 families) the 5th, C-terminal helix is missing in some of the member structures |
Family a.61.1.5: EIAV matrix antigen [69051] (1 protein) automatically mapped to Pfam PF08723 |
Protein EIAV matrix antigen [69052] (1 species) |
Species Equine infectious anemia virus, EIAV [TaxId:11665] [69053] (1 PDB entry) |
Domain d1hekb1: 1hek B:1-109 [65819] Other proteins in same PDB: d1heka2, d1hekb2 |
PDB Entry: 1hek (more details), 2.8 Å
SCOPe Domain Sequences for d1hekb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hekb1 a.61.1.5 (B:1-109) EIAV matrix antigen {Equine infectious anemia virus, EIAV [TaxId: 11665]} mgdpltwskalkklekvtvqgsqklttgncnwalslvdlfhdtnfvkekdwqlrdvipll edvtqtlsgqereafertwwaisavkmglqinnvvdgkasfqllrakye
Timeline for d1hekb1: