SCOPe 2.07: Domain d1hekb1: 1hek B:1-109

Lineage for d1hekb1 (1hek B:1-109)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.61: Retroviral matrix proteins [47835] (1 superfamily)
   4-5 helices; right-handed superhelix

4. Superfamily a.61.1: Retroviral matrix proteins [47836] (6 families)
   the 5th, C-terminal helix is missing in some of the member structures

5. Family a.61.1.5: EIAV matrix antigen [69051] (1 protein)
   automatically mapped to Pfam PF08723

6. Protein EIAV matrix antigen [69052] (1 species)

7. Species Equine infectious anemia virus, EIAV [TaxId:11665] [69053] (1 PDB entry)

8. Domain d1hekb1: 1hek B:1-109 [65819]
   Other proteins in same PDB: d1heka2, d1hekb2

Details for d1hekb1

PDB Entry: 1hek, 2.8 Å

PDB Description: crystal structure of equine infectious anaemia virus matrix antigen (eiav ma)

PDB Compounds: (B:) gag polyprotein, core protein p15

SCOPe Domain Sequences for d1hekb1:

Sequence; same for both SEQRES and ATOM records:

>d1hekb1 a.61.1.5 (B:1-109) EIAV matrix antigen {Equine infectious anemia virus, EIAV [TaxId: 11665]}
mgdpltwskalkklekvtvqgsqklttgncnwalslvdlfhdtnfvkekdwqlrdvipll
edvtqtlsgqereafertwwaisavkmglqinnvvdgkasfqllrakye

Timeline for d1hekb1:

• d1hekb1 first appeared in SCOP 1.59, called d1hekb_
  
• d1hekb1 appears in SCOPe 2.06
  
• d1hekb1 appears in the current release, SCOPe 2.08