Lineage for d1h92a_ (1h92 A:)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 109314Fold b.34: SH3-like barrel [50036] (9 superfamilies)
  4. 109356Superfamily b.34.2: SH3-domain [50044] (1 family) (S)
  5. 109357Family b.34.2.1: SH3-domain [50045] (20 proteins)
  6. 109492Protein p56-lck tyrosine kinase, SH3 domain [50076] (1 species)
  7. 109493Species Human (Homo sapiens) [TaxId:9606] [50077] (3 PDB entries)
  8. 109495Domain d1h92a_: 1h92 A: [65741]

Details for d1h92a_

PDB Entry: 1h92 (more details)

PDB Description: sh3 domain of human lck tyrosine kinase

SCOP Domain Sequences for d1h92a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h92a_ b.34.2.1 (A:) p56-lck tyrosine kinase, SH3 domain {Human (Homo sapiens)}
gsplqdnlvialhsyepshdgdlgfekgeqlrileqsgewwkaqslttgqegfipfnfva
kan

SCOP Domain Coordinates for d1h92a_:

Click to download the PDB-style file with coordinates for d1h92a_.
(The format of our PDB-style files is described here.)

Timeline for d1h92a_: