SCOP 1.71: Domain d1h8fb_: 1h8f B:

Lineage for d1h8fb_ (1h8f B:)

1. Root: SCOP 1.71

2. Class d: Alpha and beta proteins (a+b) [53931] (286 folds)

3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
   consists of two alpha+beta domains, C-terminal domain is mostly alpha helical

4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (7 families)
   shares functional and structural similarities with the ATP-grasp fold and PIPK

5. Family d.144.1.7: Protein kinases, catalytic subunit [88854] (60 proteins)
   members organized in the groups and subfamiles specified by the comments

6. Protein Glycogen synthase kinase-3 beta (Gsk3b) [69823] (1 species)
   CMGC group; GSK3 subfamily; serine/threonine kinase

7. Species Human (Homo sapiens) [TaxId:9606] [69824] (14 PDB entries)

8. Domain d1h8fb_: 1h8f B: [65734]
   complexed with epe

Details for d1h8fb_

PDB Entry: 1h8f, 2.8 Å

PDB Description: glycogen synthase kinase 3 beta.

SCOP Domain Sequences for d1h8fb_:

Sequence; same for both SEQRES and ATOM records:

>d1h8fb_ d.144.1.7 (B:) Glycogen synthase kinase-3 beta (Gsk3b) {Human (Homo sapiens)}
skvttvvatpgqgpdrpqevsytdtkvigngsfgvvyqaklcdsgelvaikkvlqgkafk
nrelqimrkldhcnivrlryffyssgekkdevylnlvldyvpetvyrvarhysrakqtlp
viyvklymyqlfrslayihsfgichrdikpqnllldpdtavlklcdfgsakqlvrgepnv
syicsryyrapelifgatdytssidvwsagcvlaelllgqpifpgdsgvdqlveiikvlg
tptreqiremnpnytefafpqikahpwtkvfrprtppeaialcsrlleytptarltplea
cahsffdelrdpnvklpngrdtpalfnfttqelssnpplatilipphari

Timeline for d1h8fb_:

• d1h8fb_ first appeared in SCOP 1.59
  
• d1h8fb_ appears in SCOP 1.69
  
• d1h8fb_ appears in SCOP 1.73
  
• d1h8fb_ appears in the current release, SCOPe 2.08