Lineage for d1h8fa_ (1h8f A:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2218047Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2218048Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2218179Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 2219622Protein Glycogen synthase kinase-3 beta (Gsk3b) [69823] (1 species)
    CMGC group; GSK3 subfamily; serine/threonine kinase
  7. 2219623Species Human (Homo sapiens) [TaxId:9606] [69824] (43 PDB entries)
    Uniprot P49841 35-383 ! Uniprot P49841 35-384
  8. 2219684Domain d1h8fa_: 1h8f A: [65733]
    complexed with epe

Details for d1h8fa_

PDB Entry: 1h8f (more details), 2.8 Å

PDB Description: glycogen synthase kinase 3 beta.
PDB Compounds: (A:) Glycogen synthase kinase-3 beta

SCOPe Domain Sequences for d1h8fa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h8fa_ d.144.1.7 (A:) Glycogen synthase kinase-3 beta (Gsk3b) {Human (Homo sapiens) [TaxId: 9606]}
skvttvvatpgqgpdrpqevsytdtkvigngsfgvvyqaklcdsgelvaikkvlqgkafk
nrelqimrkldhcnivrlryffyssgekkdevylnlvldyvpetvyrvarhysrakqtlp
viyvklymyqlfrslayihsfgichrdikpqnllldpdtavlklcdfgsakqlvrgepnv
syicsryyrapelifgatdytssidvwsagcvlaelllgqpifpgdsgvdqlveiikvlg
tptreqiremnpnytefafpqikahpwtkvfrprtppeaialcsrlleytptarltplea
cahsffdelrdpnvklpngrdtpalfnfttqelssnpplatilipphariqa

SCOPe Domain Coordinates for d1h8fa_:

Click to download the PDB-style file with coordinates for d1h8fa_.
(The format of our PDB-style files is described here.)

Timeline for d1h8fa_: