Lineage for d1h8fa_ (1h8f A:)

  1. Root: SCOP 1.59
  2. 128814Class d: Alpha and beta proteins (a+b) [53931] (208 folds)
  3. 138043Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
  4. 138044Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (6 families) (S)
  5. 138045Family d.144.1.1: Serine/threonin kinases [56113] (17 proteins)
  6. 138134Protein Glycogen synthase kinase-3 beta (Gsk3b) [69823] (1 species)
  7. 138135Species Human (Homo sapiens) [TaxId:9606] [69824] (2 PDB entries)
  8. 138136Domain d1h8fa_: 1h8f A: [65733]

Details for d1h8fa_

PDB Entry: 1h8f (more details), 2.8 Å

PDB Description: glycogen synthase kinase 3 beta.

SCOP Domain Sequences for d1h8fa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h8fa_ d.144.1.1 (A:) Glycogen synthase kinase-3 beta (Gsk3b) {Human (Homo sapiens)}
skvttvvatpgqgpdrpqevsytdtkvigngsfgvvyqaklcdsgelvaikkvlqgkafk
nrelqimrkldhcnivrlryffyssgekkdevylnlvldyvpetvyrvarhysrakqtlp
viyvklymyqlfrslayihsfgichrdikpqnllldpdtavlklcdfgsakqlvrgepnv
syicsryyrapelifgatdytssidvwsagcvlaelllgqpifpgdsgvdqlveiikvlg
tptreqiremnpnytefafpqikahpwtkvfrprtppeaialcsrlleytptarltplea
cahsffdelrdpnvklpngrdtpalfnfttqelssnpplatilipphariqa

SCOP Domain Coordinates for d1h8fa_:

Click to download the PDB-style file with coordinates for d1h8fa_.
(The format of our PDB-style files is described here.)

Timeline for d1h8fa_: