SCOP 1.59: Domain d1h85a1: 1h85 A:9-141

Lineage for d1h85a1 (1h85 A:9-141)

1. Root: SCOP 1.59

2. Class b: All beta proteins [48724] (110 folds)

3. Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (3 superfamilies)

4. Superfamily b.43.4: Riboflavin synthase domain-like [63380] (3 families)

5. Family b.43.4.2: Ferredoxin reductase FAD-binding domain-like [63381] (7 proteins)

6. Protein Ferredoxin reductase (flavodoxin reductase) N-terminal domain [50415] (8 species)

7. Species Cyanobacterium (Anabaena sp.), pcc 7119 [TaxId:1167] [50420] (12 PDB entries)

8. Domain d1h85a1: 1h85 A:9-141 [65716]
   Other proteins in same PDB: d1h85a2

Details for d1h85a1

PDB Entry: 1h85, 2.3 Å

PDB Description: ferredoxin:nadp+ reductase mutant with val 136 replaced by leu (v136l)

SCOP Domain Sequences for d1h85a1:

Sequence; same for both SEQRES and ATOM records:

>d1h85a1 b.43.4.2 (A:9-141) Ferredoxin reductase (flavodoxin reductase) N-terminal domain {Cyanobacterium (Anabaena sp.), pcc 7119}
dvpvnlyrpnapfigkvisneplvkeggigivqhikfdltggnlkyiegqsigiippgvd
kngkpeklrlysiastrhgddvddktislcvrqleykhpesgetvygvcstylthiepgs
evkitgplgkeml

Timeline for d1h85a1:

• d1h85a1 is new in SCOP 1.59
  
• d1h85a1 appears in SCOP 1.61
  
• d1h85a1 appears in the current release, SCOPe 2.08