Lineage for d1h7ub2 (1h7u B:32-231)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 871740Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily)
    8-stranded mixed beta-sheet; 2 layers: alpha/beta
  4. 871741Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (4 families) (S)
  5. 871855Family d.122.1.2: DNA gyrase/MutL, N-terminal domain [55879] (6 proteins)
  6. 871874Protein DNA mismatch repair protein PMS2 [69800] (1 species)
  7. 871875Species Human (Homo sapiens) [TaxId:9606] [69801] (3 PDB entries)
  8. 871881Domain d1h7ub2: 1h7u B:32-231 [65712]
    Other proteins in same PDB: d1h7ua1, d1h7ub1
    complexed with atg, mg

Details for d1h7ub2

PDB Entry: 1h7u (more details), 2.7 Å

PDB Description: nhpms2-atpgs
PDB Compounds: (B:) pms1 protein homolog 2

SCOP Domain Sequences for d1h7ub2:

Sequence, based on SEQRES records: (download)

>d1h7ub2 d.122.1.2 (B:32-231) DNA mismatch repair protein PMS2 {Human (Homo sapiens) [TaxId: 9606]}
vlslstavkelvensldagatnidlklkdygvdlievsdngcgveeenfegltlkhhtsk
iqefadltqvetfgfrgealsslcalsdvtistchasakvgtrlmfdhngkiiqktpypr
prgttvsvqqlfstlpvrhkefqrnikkeyakmvqvlhayciisagirvsctnqlgqgkr
qpvvctggspsikenigsvf

Sequence, based on observed residues (ATOM records): (download)

>d1h7ub2 d.122.1.2 (B:32-231) DNA mismatch repair protein PMS2 {Human (Homo sapiens) [TaxId: 9606]}
vlslstavkelvensldagatnidlklkdygvdlievsdngcgveeenfegltlealssl
calsdvtistchasakvgtrlmfdhngkiiqktpyprprgttvsvqqlfstlpvrhkefq
rnikkeyakmvqvlhayciisagirvsctnqlgqgkrqpvvctggspsikenigsvf

SCOP Domain Coordinates for d1h7ub2:

Click to download the PDB-style file with coordinates for d1h7ub2.
(The format of our PDB-style files is described here.)

Timeline for d1h7ub2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1h7ub1