Lineage for d1h7ua1 (1h7u A:232-364)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1401399Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
    core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover
  4. 1401400Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families) (S)
  5. 1401595Family d.14.1.3: DNA gyrase/MutL, second domain [54224] (6 proteins)
  6. 1401612Protein DNA mismatch repair protein PMS2 [69656] (1 species)
  7. 1401613Species Human (Homo sapiens) [TaxId:9606] [69657] (3 PDB entries)
  8. 1401618Domain d1h7ua1: 1h7u A:232-364 [65709]
    Other proteins in same PDB: d1h7ua2, d1h7ub2
    complexed with ags, mg

Details for d1h7ua1

PDB Entry: 1h7u (more details), 2.7 Å

PDB Description: nhpms2-atpgs
PDB Compounds: (A:) mismatch repair endonuclease pms2

SCOPe Domain Sequences for d1h7ua1:

Sequence, based on SEQRES records: (download)

>d1h7ua1 d.14.1.3 (A:232-364) DNA mismatch repair protein PMS2 {Human (Homo sapiens) [TaxId: 9606]}
gqkqlqslipfvqlppsdsvceeyglscsdalhnlfyisgfisqcthgvgrsstdrqfff
inrrpcdpakvcrlvnevyhmynrhqypfvvlnisvdsecvdinvtpdkrqillqeekll
lavlktsligmfd

Sequence, based on observed residues (ATOM records): (download)

>d1h7ua1 d.14.1.3 (A:232-364) DNA mismatch repair protein PMS2 {Human (Homo sapiens) [TaxId: 9606]}
gqkqlqslipfvqlppsdsvceeyglscsdalhnlfyisgfisqcthgvgrsstdrqfff
inrrpcdpakvcrlvnevyhmynrhqypfvvlnisvdsecvdinqillqeeklllavlkt
sligmfd

SCOPe Domain Coordinates for d1h7ua1:

Click to download the PDB-style file with coordinates for d1h7ua1.
(The format of our PDB-style files is described here.)

Timeline for d1h7ua1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1h7ua2