Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily) core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover |
Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families) |
Family d.14.1.3: DNA gyrase/MutL, second domain [54224] (6 proteins) |
Protein DNA mismatch repair protein PMS2 [69656] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [69657] (3 PDB entries) |
Domain d1h7ua1: 1h7u A:232-364 [65709] Other proteins in same PDB: d1h7ua2, d1h7ub2 complexed with ags, mg |
PDB Entry: 1h7u (more details), 2.7 Å
SCOPe Domain Sequences for d1h7ua1:
Sequence, based on SEQRES records: (download)
>d1h7ua1 d.14.1.3 (A:232-364) DNA mismatch repair protein PMS2 {Human (Homo sapiens) [TaxId: 9606]} gqkqlqslipfvqlppsdsvceeyglscsdalhnlfyisgfisqcthgvgrsstdrqfff inrrpcdpakvcrlvnevyhmynrhqypfvvlnisvdsecvdinvtpdkrqillqeekll lavlktsligmfd
>d1h7ua1 d.14.1.3 (A:232-364) DNA mismatch repair protein PMS2 {Human (Homo sapiens) [TaxId: 9606]} gqkqlqslipfvqlppsdsvceeyglscsdalhnlfyisgfisqcthgvgrsstdrqfff inrrpcdpakvcrlvnevyhmynrhqypfvvlnisvdsecvdinqillqeeklllavlkt sligmfd
Timeline for d1h7ua1: