SCOP 1.59: Domain d1h7ua1: 1h7u A:232-364

Lineage for d1h7ua1 (1h7u A:232-364)

1. Root: SCOP 1.59

2. Class d: Alpha and beta proteins (a+b) [53931] (208 folds)

3. Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)

4. Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (5 families)

5. Family d.14.1.3: DNA gyrase/MutL, second domain [54224] (3 proteins)

6. Protein DNA mismatch repair protein PMS2 [69656] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [69657] (3 PDB entries)

8. Domain d1h7ua1: 1h7u A:232-364 [65709]
   Other proteins in same PDB: d1h7ua2, d1h7ub2

Details for d1h7ua1

PDB Entry: 1h7u, 2.7 Å

PDB Description: nhpms2-atpgs

SCOP Domain Sequences for d1h7ua1:

Sequence, based on SEQRES records:

>d1h7ua1 d.14.1.3 (A:232-364) DNA mismatch repair protein PMS2 {Human (Homo sapiens)}
gqkqlqslipfvqlppsdsvceeyglscsdalhnlfyisgfisqcthgvgrsstdrqfff
inrrpcdpakvcrlvnevyhmynrhqypfvvlnisvdsecvdinvtpdkrqillqeekll
lavlktsligmfd

Sequence, based on observed residues (ATOM records):

>d1h7ua1 d.14.1.3 (A:232-364) DNA mismatch repair protein PMS2 {Human (Homo sapiens)}
gqkqlqslipfvqlppsdsvceeyglscsdalhnlfyisgfisqcthgvgrsstdrqfff
inrrpcdpakvcrlvnevyhmynrhqypfvvlnisvdsecvdinqillqeeklllavlkt
sligmfd

Timeline for d1h7ua1:

• d1h7ua1 is new in SCOP 1.59
  
• d1h7ua1 appears in SCOP 1.61
  
• d1h7ua1 appears in the current release, SCOPe 2.08