Lineage for d1h7sa2 (1h7s A:29-231)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 871740Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily)
    8-stranded mixed beta-sheet; 2 layers: alpha/beta
  4. 871741Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (4 families) (S)
  5. 871855Family d.122.1.2: DNA gyrase/MutL, N-terminal domain [55879] (6 proteins)
  6. 871874Protein DNA mismatch repair protein PMS2 [69800] (1 species)
  7. 871875Species Human (Homo sapiens) [TaxId:9606] [69801] (3 PDB entries)
  8. 871876Domain d1h7sa2: 1h7s A:29-231 [65706]
    Other proteins in same PDB: d1h7sa1, d1h7sb1

Details for d1h7sa2

PDB Entry: 1h7s (more details), 1.95 Å

PDB Description: n-terminal 40kda fragment of human pms2
PDB Compounds: (A:) pms1 protein homolog 2

SCOP Domain Sequences for d1h7sa2:

Sequence, based on SEQRES records: (download)

>d1h7sa2 d.122.1.2 (A:29-231) DNA mismatch repair protein PMS2 {Human (Homo sapiens) [TaxId: 9606]}
gqvvlslstavkelvensldagatnidlklkdygvdlievsdngcgveeenfegltlkhh
tskiqefadltqvetfgfrgealsslcalsdvtistchasakvgtrlmfdhngkiiqktp
yprprgttvsvqqlfstlpvrhkefqrnikkeyakmvqvlhayciisagirvsctnqlgq
gkrqpvvctggspsikenigsvf

Sequence, based on observed residues (ATOM records): (download)

>d1h7sa2 d.122.1.2 (A:29-231) DNA mismatch repair protein PMS2 {Human (Homo sapiens) [TaxId: 9606]}
gqvvlslstavkelvensldagatnidlklkdygvdlievsdngcgveeenfegltladl
tqvetfgfrgealsslcalsdvtistchasakvgtrlmfdhngkiiqktpyprprgttvs
vqqlfstlpvrhkefqrnikkeyakmvqvlhayciisagirvsctnqlgqgkrqpvvctg
gspsikenigsvf

SCOP Domain Coordinates for d1h7sa2:

Click to download the PDB-style file with coordinates for d1h7sa2.
(The format of our PDB-style files is described here.)

Timeline for d1h7sa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1h7sa1