Lineage for d1h7sa1 (1h7s A:232-365)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2176343Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
    core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover
  4. 2176344Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families) (S)
  5. 2176534Family d.14.1.3: DNA gyrase/MutL, second domain [54224] (6 proteins)
  6. 2176551Protein DNA mismatch repair protein PMS2 [69656] (1 species)
  7. 2176552Species Human (Homo sapiens) [TaxId:9606] [69657] (3 PDB entries)
  8. 2176553Domain d1h7sa1: 1h7s A:232-365 [65705]
    Other proteins in same PDB: d1h7sa2, d1h7sb2

Details for d1h7sa1

PDB Entry: 1h7s (more details), 1.95 Å

PDB Description: n-terminal 40kda fragment of human pms2
PDB Compounds: (A:) pms1 protein homolog 2

SCOPe Domain Sequences for d1h7sa1:

Sequence, based on SEQRES records: (download)

>d1h7sa1 d.14.1.3 (A:232-365) DNA mismatch repair protein PMS2 {Human (Homo sapiens) [TaxId: 9606]}
gqkqlqslipfvqlppsdsvceeyglscsdalhnlfyisgfisqcthgvgrsstdrqfff
inrrpcdpakvcrlvnevyhmynrhqypfvvlnisvdsecvdinvtpdkrqillqeekll
lavlktsligmfds

Sequence, based on observed residues (ATOM records): (download)

>d1h7sa1 d.14.1.3 (A:232-365) DNA mismatch repair protein PMS2 {Human (Homo sapiens) [TaxId: 9606]}
gqkqlqslipfvqlppsdsvceeyglscsdalhnlfyisgfisqcthgvgrsstdrqfff
inrrpcdpakvcrlvnevyhmynrhqypfvvlnisvdsecvdinqillqeeklllavlkt
sligmfds

SCOPe Domain Coordinates for d1h7sa1:

Click to download the PDB-style file with coordinates for d1h7sa1.
(The format of our PDB-style files is described here.)

Timeline for d1h7sa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1h7sa2