Lineage for d1h6w.1 (1h6w A:,B:)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 235516Fold b.108: Triple-stranded beta-helix [69348] (1 superfamily)
    (homo)trimer; each chain donates 3 beta-strands per turn of the helix
  4. 235517Superfamily b.108.1: Phage fibre proteins [69349] (2 families) (S)
  5. 235518Family b.108.1.1: Heat- and protease-stable fragment of the short fibre [69350] (1 protein)
  6. 235519Protein Heat- and protease-stable fragment of the short fibre [69351] (1 species)
    includes the N- and C-terminal cap (sub)domains
  7. 235520Species Bacteriophage T4 [TaxId:10665] [69352] (1 PDB entry)
  8. 235521Domain d1h6w.1: 1h6w A:,B: [65690]

Details for d1h6w.1

PDB Entry: 1h6w (more details), 1.9 Å

PDB Description: crystal structure of a heat- and protease-stable fragment of the bacteriophage t4 short fibre

SCOP Domain Sequences for d1h6w.1:

Sequence; same for both SEQRES and ATOM records: (download)

>g1h6w.1 b.108.1.1 (A:,B:) Heat- and protease-stable fragment of the short fibre {Bacteriophage T4}
tgatlngrgsttsmrgvvkltttagsqsggdassalawnadvihqrggqtingtlrinnt
ltiasgganitgtvnmtggyiqgkrvvtqneidrtipvgaimmwaadslpsdawrfchgg
tvsasdcplyasrigtryggsssnpglpdmrXslnyiikvke

SCOP Domain Coordinates for d1h6w.1:

Click to download the PDB-style file with coordinates for d1h6w.1.
(The format of our PDB-style files is described here.)

Timeline for d1h6w.1: