Lineage for d1h6ea_ (1h6e A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2767182Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 2768498Superfamily b.2.7: Second domain of Mu2 adaptin subunit (ap50) of ap2 adaptor [49447] (2 families) (S)
    duplication: one domain of this fold is inserted into another domain of the same fold
  5. 2768499Family b.2.7.1: Second domain of Mu2 adaptin subunit (ap50) of ap2 adaptor [49448] (1 protein)
    automatically mapped to Pfam PF00928
  6. 2768500Protein Second domain of Mu2 adaptin subunit (ap50) of ap2 adaptor [49449] (2 species)
  7. 2768501Species Human (Homo sapiens) [TaxId:9606] [69187] (1 PDB entry)
  8. 2768502Domain d1h6ea_: 1h6e A: [65680]
    complexed with ctla-4 internalization peptide ttgvyvkmppt

Details for d1h6ea_

PDB Entry: 1h6e (more details), 3.6 Å

PDB Description: mu2 adaptin subunit (ap50) of ap2 adaptor (second domain), complexed with ctla-4 internalization peptide ttgvyvkmppt
PDB Compounds: (A:) clathrin coat assembly protein ap50

SCOPe Domain Sequences for d1h6ea_:

Sequence, based on SEQRES records: (download)

>d1h6ea_ b.2.7.1 (A:) Second domain of Mu2 adaptin subunit (ap50) of ap2 adaptor {Human (Homo sapiens) [TaxId: 9606]}
ikyrrnelfldvlesvnllmspqgqvlsahvsgrvvmksylsgmpeckfgmndkiviekq
gkgtadetsksgkqsiaiddctfhqcvrlskfdsersisfippdgefelmryrttkdiil
pfrviplvrevgrtklevkvviksnfkpsllaqkievriptplntsgvqvicmkgkakyk
asenaivwkikrmagmkesqisaeiellptndkkkwarppismnfevpfapsglkvrylk
vfepklnysdhdvikwvryigrsgiyetrc

Sequence, based on observed residues (ATOM records): (download)

>d1h6ea_ b.2.7.1 (A:) Second domain of Mu2 adaptin subunit (ap50) of ap2 adaptor {Human (Homo sapiens) [TaxId: 9606]}
ikyrrnelfldvlesvnllmspqgqvlsahvsgrvvmksylsgmpeckfgmndsisfipp
dgefelmryrttkdiilpfrviplvrevgrtklevkvviksnfkpsllaqkievriptpl
ntsgvqvicmkgkakykasenaivwkikrmagmkesqisaeiellptppismnfevpfap
sglkvrylkvfepklnysdhdvikwvryigrsgiyetrc

SCOPe Domain Coordinates for d1h6ea_:

Click to download the PDB-style file with coordinates for d1h6ea_.
(The format of our PDB-style files is described here.)

Timeline for d1h6ea_: