Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (22 proteins) family members also share a common alpha+beta fold in C-terminal domain |
Protein Glucose-fructose oxidoreductase, N-terminal domain [51825] (1 species) |
Species Zymomonas mobilis [TaxId:542] [51826] (8 PDB entries) |
Domain d1h6dc1: 1h6d C:52-212,C:375-433 [65660] Other proteins in same PDB: d1h6da2, d1h6db2, d1h6dc2, d1h6dd2, d1h6de2, d1h6df2, d1h6dg2, d1h6dh2, d1h6di2, d1h6dj2, d1h6dk2, d1h6dl2 complexed with gol, ndp |
PDB Entry: 1h6d (more details), 2.05 Å
SCOPe Domain Sequences for d1h6dc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1h6dc1 c.2.1.3 (C:52-212,C:375-433) Glucose-fructose oxidoreductase, N-terminal domain {Zymomonas mobilis [TaxId: 542]} aatlpagasqvpttpagrpmpyairpmpedrrfgyaivglgkyalnqilpgfagcqhsri ealvsgnaekakivaaeygvdprkiydysnfdkiakdpkidavyiilpnslhaefairaf kagkhvmcekpmatsvadcqrmidaakaankklmigyrchyXnqfsaqldhlaeavinnk pvrspgeegmqdvrliqaiyeaartgrpvntdwgyvrqggy
Timeline for d1h6dc1: