SCOPe 2.06: Domain d1h65c1: 1h65 C:8-258

Lineage for d1h65c1 (1h65 C:8-258)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (79 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein Chloroplast protein translocon GTPase Toc34 [69485] (1 species)

7. Species Pea (Pisum sativum) [TaxId:3888] [69486] (1 PDB entry)

8. Domain d1h65c1: 1h65 C:8-258 [65642]
   Other proteins in same PDB: d1h65a2, d1h65b2, d1h65c2
   complexed with gdp, mg

Details for d1h65c1

PDB Entry: 1h65, 2 Å

PDB Description: crystal structure of pea toc34 - a novel gtpase of the chloroplast protein translocon

PDB Compounds: (C:) chloroplast outer envelope protein oep34

SCOPe Domain Sequences for d1h65c1:

Sequence; same for both SEQRES and ATOM records:

>d1h65c1 c.37.1.8 (C:8-258) Chloroplast protein translocon GTPase Toc34 {Pea (Pisum sativum) [TaxId: 3888]}
vrewsgintfapatqtkllellgnlkqedvnsltilvmgkggvgksstvnsiigervvsi
spfqsegprpvmvsrsragftlniidtpglieggyindmalniiksflldktidvllyvd
rldayrvdnldklvakaitdsfgkgiwnkaivalthaqfsppdglpydeffskrseallq
vvrsgaslkkdaqasdipvvliensgrcnkndsdekvlpngiawiphlvqtitevalnks
esifvdknlid

Timeline for d1h65c1:

• d1h65c1 first appeared in SCOP 1.59, called d1h65c_
  
• d1h65c1 was called d1h65c_ in SCOPe 2.05
  
• d1h65c1 appears in SCOPe 2.07
  
• d1h65c1 appears in the current release, SCOPe 2.08