SCOP 1.59: Domain d1h65c_: 1h65 C:

Lineage for d1h65c_ (1h65 C:)

1. Root: SCOP 1.59

2. Class c: Alpha and beta proteins (a/b) [51349] (113 folds)

3. Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily)

4. Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (16 families)

5. Family c.37.1.8: G proteins [52592] (23 proteins)

6. Protein Chloroplast protein translocon GTPase Toc34 [69485] (1 species)

7. Species Garden pea (Pisum sativum) [TaxId:3888] [69486] (1 PDB entry)

8. Domain d1h65c_: 1h65 C: [65642]

Details for d1h65c_

PDB Entry: 1h65, 2 Å

PDB Description: crystal structure of pea toc34 - a novel gtpase of the chloroplast protein translocon

SCOP Domain Sequences for d1h65c_:

Sequence; same for both SEQRES and ATOM records:

>d1h65c_ c.37.1.8 (C:) Chloroplast protein translocon GTPase Toc34 {Garden pea (Pisum sativum)}
vrewsgintfapatqtkllellgnlkqedvnsltilvmgkggvgksstvnsiigervvsi
spfqsegprpvmvsrsragftlniidtpglieggyindmalniiksflldktidvllyvd
rldayrvdnldklvakaitdsfgkgiwnkaivalthaqfsppdglpydeffskrseallq
vvrsgaslkkdaqasdipvvliensgrcnkndsdekvlpngiawiphlvqtitevalnks
esifvdknlidklaaa

Timeline for d1h65c_:

• d1h65c_ is new in SCOP 1.59
  
• d1h65c_ appears in SCOP 1.61
  
• d1h65c_ appears in the current release, SCOPe 2.08, called d1h65c1