Lineage for d1h65b_ (1h65 B:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1362078Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 1362079Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 1362829Family c.37.1.8: G proteins [52592] (79 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 1363074Protein Chloroplast protein translocon GTPase Toc34 [69485] (1 species)
  7. 1363075Species Pea (Pisum sativum) [TaxId:3888] [69486] (1 PDB entry)
  8. 1363077Domain d1h65b_: 1h65 B: [65641]
    complexed with gdp, mg

Details for d1h65b_

PDB Entry: 1h65 (more details), 2 Å

PDB Description: crystal structure of pea toc34 - a novel gtpase of the chloroplast protein translocon
PDB Compounds: (B:) chloroplast outer envelope protein oep34

SCOPe Domain Sequences for d1h65b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h65b_ c.37.1.8 (B:) Chloroplast protein translocon GTPase Toc34 {Pea (Pisum sativum) [TaxId: 3888]}
tvrewsgintfapatqtkllellgnlkqedvnsltilvmgkggvgksstvnsiigervvs
ispfqsegprpvmvsrsragftlniidtpglieggyindmalniiksflldktidvllyv
drldayrvdnldklvakaitdsfgkgiwnkaivalthaqfsppdglpydeffskrseall
qvvrsgaslkkdaqasdipvvliensgrcnkndsdekvlpngiawiphlvqtitevalnk
sesifvdknlidklaa

SCOPe Domain Coordinates for d1h65b_:

Click to download the PDB-style file with coordinates for d1h65b_.
(The format of our PDB-style files is described here.)

Timeline for d1h65b_: