SCOP 1.75: Domain d1h4rb3: 1h4r B:20-103

Lineage for d1h4rb3 (1h4r B:20-103)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.1: Ubiquitin-like [54236] (8 families)

5. Family d.15.1.4: First domain of FERM [54256] (6 proteins)

6. Protein Merlin [69660] (2 species)
   the neurofibromatosis 2 tumor suppressor protein

7. Species Human (Homo sapiens) [TaxId:9606] [69661] (1 PDB entry)

8. Domain d1h4rb3: 1h4r B:20-103 [65621]
   Other proteins in same PDB: d1h4ra1, d1h4ra2, d1h4rb1, d1h4rb2
   complexed with so4

Details for d1h4rb3

PDB Entry: 1h4r, 1.8 Å

PDB Description: crystal structure of the ferm domain of merlin, the neurofibromatosis 2 tumor suppressor protein.

PDB Compounds: (B:) merlin

SCOP Domain Sequences for d1h4rb3:

Sequence; same for both SEQRES and ATOM records:

>d1h4rb3 d.15.1.4 (B:20-103) Merlin {Human (Homo sapiens) [TaxId: 9606]}
ktftvrivtmdaemefncemkwkgkdlfdlvcrtlglretwffglqytikdtvawlkmdk
kvldhdvskeepvtfhflakfype

Timeline for d1h4rb3:

• d1h4rb3 first appeared in SCOP 1.59
  
• d1h4rb3 appears in SCOP 1.73
  
• d1h4rb3 appears in SCOPe 2.01
  
• d1h4rb3 appears in the current release, SCOPe 2.08