SCOP 1.75: Domain d1h4rb2: 1h4r B:215-313

Lineage for d1h4rb2 (1h4r B:215-313)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.55: PH domain-like barrel [50728] (2 superfamilies)
   barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix

4. Superfamily b.55.1: PH domain-like [50729] (13 families)

5. Family b.55.1.5: Third domain of FERM [50776] (8 proteins)

6. Protein Merlin [69294] (2 species)
   the neurofibromatosis 2 tumor suppressor protein

7. Species Human (Homo sapiens) [TaxId:9606] [69295] (1 PDB entry)

8. Domain d1h4rb2: 1h4r B:215-313 [65620]
   Other proteins in same PDB: d1h4ra1, d1h4ra3, d1h4rb1, d1h4rb3
   complexed with so4

Details for d1h4rb2

PDB Entry: 1h4r, 1.8 Å

PDB Description: crystal structure of the ferm domain of merlin, the neurofibromatosis 2 tumor suppressor protein.

PDB Compounds: (B:) merlin

SCOP Domain Sequences for d1h4rb2:

Sequence; same for both SEQRES and ATOM records:

>d1h4rb2 b.55.1.5 (B:215-313) Merlin {Human (Homo sapiens) [TaxId: 9606]}
emygvnyfairnkkgtelllgvdalglhiydpenrltpkisfpwneirnisysdkeftik
pldkkidvfkfnssklrvnklilqlcignhdlfmrrrka

Timeline for d1h4rb2:

• d1h4rb2 first appeared in SCOP 1.59
  
• d1h4rb2 appears in SCOP 1.73
  
• d1h4rb2 appears in SCOPe 2.01
  
• d1h4rb2 appears in the current release, SCOPe 2.08