Class c: Alpha and beta proteins (a/b) [51349] (130 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (11 families) |
Family c.2.1.5: LDH N-terminal domain-like [51848] (7 proteins) |
Protein Malate dehydrogenase [51849] (11 species) |
Species Chlorobium vibrioforme [TaxId:1098] [69417] (2 PDB entries) |
Domain d1guzb1: 1guz B:1-142 [65588] Other proteins in same PDB: d1guza2, d1guzb2, d1guzc2, d1guzd2 |
PDB Entry: 1guz (more details), 2 Å
SCOP Domain Sequences for d1guzb1:
Sequence, based on SEQRES records: (download)
>d1guzb1 c.2.1.5 (B:1-142) Malate dehydrogenase {Chlorobium vibrioforme} mkitvigagnvgattafrlaekqlarelvlldvvegipqgkaldmyesgpvglfdtkvtg sndyadtansdiviitaglprkpgmtredllmknagivkevtdnimkhsknpiiivvsnp ldimthvawvrsglpkervigm
>d1guzb1 c.2.1.5 (B:1-142) Malate dehydrogenase {Chlorobium vibrioforme} mkitvigagnvgattafrlaekqlarelvlldvvegipqgkaldmyesgpvglfdtkvtg sndyadtansdiviitagldllmknagivkevtdnimkhsknpiiivvsnpldimthvaw vrsglpkervigm
Timeline for d1guzb1: