Lineage for d1guyc2 (1guy C:144-306)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2556795Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
    unusual fold, defines family
  4. 2556796Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families) (S)
  5. 2556797Family d.162.1.1: Lactate & malate dehydrogenases, C-terminal domain [56328] (5 proteins)
    N-terminal domain is NAD-binding module (alpha/beta Rossmann-fold domain)
    automatically mapped to Pfam PF02866
  6. 2557069Protein Malate dehydrogenase [56329] (12 species)
  7. 2557086Species Chloroflexus aurantiacus [TaxId:1108] [69840] (7 PDB entries)
    Uniprot P80040
  8. 2557090Domain d1guyc2: 1guy C:144-306 [65585]
    Other proteins in same PDB: d1guya1, d1guyc1
    complexed with cd, nad

Details for d1guyc2

PDB Entry: 1guy (more details), 2.2 Å

PDB Description: structural basis for thermophilic protein stability: structures of thermophilic and mesophilic malate dehydrogenases
PDB Compounds: (C:) malate dehydrogenase

SCOPe Domain Sequences for d1guyc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1guyc2 d.162.1.1 (C:144-306) Malate dehydrogenase {Chloroflexus aurantiacus [TaxId: 1108]}
agvldaaryrtfiameagvsvedvqamlmgghgdemvplprfstisgipvsefiapdrla
qivertrkgggeivnllktgsayyapaaataqmveavlkdkkrvmpvaayltgqyglndi
yfgvpvilgaggvekilelplneeemallnasakavratldtl

SCOPe Domain Coordinates for d1guyc2:

Click to download the PDB-style file with coordinates for d1guyc2.
(The format of our PDB-style files is described here.)

Timeline for d1guyc2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1guyc1