Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.17: Caspase-like [52128] (1 superfamily) 3 layers, a/b/a; core: mixed beta-sheet of 6 strands, order 213456, strand 6 is antiparallel to the rest |
Superfamily c.17.1: Caspase-like [52129] (3 families) mature protein may be composed of two chains folded in a single domain |
Family c.17.1.1: Caspase catalytic domain [52130] (8 proteins) |
Protein Caspase-7 [63961] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [63962] (12 PDB entries) Uniprot P55210 57-303 |
Domain d1gqfa1: 1gqf A:140-402 [65470] Other proteins in same PDB: d1gqfa2, d1gqfb2 complexed with so4 |
PDB Entry: 1gqf (more details), 2.9 Å
SCOPe Domain Sequences for d1gqfa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gqfa1 c.17.1.1 (A:140-402) Caspase-7 {Human (Homo sapiens) [TaxId: 9606]} sikttrdrvptyqynmnfeklgkciiinnknfdkvtgmgvrngtdkdaealfkcfrslgf dvivyndcscakmqdllkkaseedhtnaacfacillshgeenviygkdgvtpikdltahf rgdrcktllekpklffiqaargtelddgiqadsgpindtdanprykipveadflfaystv pgyyswrspgrgswfvqalcsileehgkdleimqiltrvndrvarhfesqsddphfhekk qipcvvsmltkelyfsq
Timeline for d1gqfa1: