Lineage for d1gqfa1 (1gqf A:140-402)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2463073Fold c.17: Caspase-like [52128] (1 superfamily)
    3 layers, a/b/a; core: mixed beta-sheet of 6 strands, order 213456, strand 6 is antiparallel to the rest
  4. 2463074Superfamily c.17.1: Caspase-like [52129] (3 families) (S)
    mature protein may be composed of two chains folded in a single domain
  5. 2463075Family c.17.1.1: Caspase catalytic domain [52130] (8 proteins)
  6. 2463126Protein Caspase-7 [63961] (1 species)
  7. 2463127Species Human (Homo sapiens) [TaxId:9606] [63962] (12 PDB entries)
    Uniprot P55210 57-303
  8. 2463148Domain d1gqfa1: 1gqf A:140-402 [65470]
    Other proteins in same PDB: d1gqfa2, d1gqfb2
    complexed with so4

Details for d1gqfa1

PDB Entry: 1gqf (more details), 2.9 Å

PDB Description: crystal structure of human procaspase-7
PDB Compounds: (A:) caspase-7

SCOPe Domain Sequences for d1gqfa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gqfa1 c.17.1.1 (A:140-402) Caspase-7 {Human (Homo sapiens) [TaxId: 9606]}
sikttrdrvptyqynmnfeklgkciiinnknfdkvtgmgvrngtdkdaealfkcfrslgf
dvivyndcscakmqdllkkaseedhtnaacfacillshgeenviygkdgvtpikdltahf
rgdrcktllekpklffiqaargtelddgiqadsgpindtdanprykipveadflfaystv
pgyyswrspgrgswfvqalcsileehgkdleimqiltrvndrvarhfesqsddphfhekk
qipcvvsmltkelyfsq

SCOPe Domain Coordinates for d1gqfa1:

Click to download the PDB-style file with coordinates for d1gqfa1.
(The format of our PDB-style files is described here.)

Timeline for d1gqfa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1gqfa2