Class c: Alpha and beta proteins (a/b) [51349] (113 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (24 superfamilies) |
Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (4 families) |
Family c.1.2.1: Histidine biosynthesis enzymes [51367] (2 proteins) |
Protein Cyclase subunit (or domain) of imidazoleglycerolphosphate synthase HisF [51370] (3 species) |
Species Thermotoga maritima [TaxId:243274] [51371] (2 PDB entries) |
Domain d1gpwe_: 1gpw E: [65464] Other proteins in same PDB: d1gpwb_, d1gpwd_, d1gpwf_ |
PDB Entry: 1gpw (more details), 2.4 Å
SCOP Domain Sequences for d1gpwe_:
Sequence, based on SEQRES records: (download)
>d1gpwe_ c.1.2.1 (E:) Cyclase subunit (or domain) of imidazoleglycerolphosphate synthase HisF {Thermotoga maritima} mlakriiaclnvkdgrvvkgtnfenlrdsgdpvelgkfyseigidelvflditasvekrk tmlelvekvaeqidipftvgggihdfetaselilrgadkvsintaavenpslitqiaqtf gsqavvvaidakrvdgefmvftysgkkntgillrdwvvevekrgageilltsidrdgtks gydtemirfvrplttlpiiasggagkmehfleaflagadaalaasvfhfreidvrelkey lkkhgvnvrlegl
>d1gpwe_ c.1.2.1 (E:) Cyclase subunit (or domain) of imidazoleglycerolphosphate synthase HisF {Thermotoga maritima} mlakriiaclnvkdgrvvknfenlrdsgdpvelgkfyseigidelvflditasvekrktm lelvekvaeqidipftvgggihdfetaselilrgadkvsintaavenpslitqiaqtfgs qavvvaidakrvdgefmvftysgkkntgillrdwvvevekrgageilltsidrdgtksgy dtemirfvrplttlpiiasggagkmehfleaflagadaalaasvfhfreidvrelkeylk khgvnvrlegl
Timeline for d1gpwe_: