SCOP 1.61: Domain d1gpub3: 1gpu B:535-680

Lineage for d1gpub3 (1gpu B:535-680)

1. Root: SCOP 1.61

2. Class c: Alpha and beta proteins (a/b) [51349] (117 folds)

3. Fold c.48: Transketolase C-terminal domain-like [52921] (1 superfamily)

4. Superfamily c.48.1: Transketolase C-terminal domain-like [52922] (3 families)

5. Family c.48.1.1: TK-like [52923] (2 proteins)

6. Protein Transketolase, TK [52924] (1 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [52925] (7 PDB entries)

8. Domain d1gpub3: 1gpu B:535-680 [65459]
   Other proteins in same PDB: d1gpua1, d1gpua2, d1gpub1, d1gpub2

Details for d1gpub3

PDB Entry: 1gpu, 1.86 Å

PDB Description: transketolase complex with reaction intermediate

SCOP Domain Sequences for d1gpub3:

Sequence; same for both SEQRES and ATOM records:

>d1gpub3 c.48.1.1 (B:535-680) Transketolase, TK {Baker's yeast (Saccharomyces cerevisiae)}
egssiesaskggyvlqdvanpdiilvatgsevslsveaaktlaaknikarvvslpdfftf
dkqpleyrlsvlpdnvpimsvevlattcwgkyahqsfgidrfgasgkapevfkffgftpe
gvaeraqktiafykgdklisplkkaf

Timeline for d1gpub3:

• d1gpub3 first appeared in SCOP 1.59
  
• d1gpub3 appears in SCOP 1.63
  
• d1gpub3 appears in the current release, SCOPe 2.08