Class c: Alpha and beta proteins (a/b) [51349] (117 folds) |
Fold c.48: Transketolase C-terminal domain-like [52921] (1 superfamily) |
Superfamily c.48.1: Transketolase C-terminal domain-like [52922] (3 families) |
Family c.48.1.1: TK-like [52923] (2 proteins) |
Protein Transketolase, TK [52924] (1 species) |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [52925] (7 PDB entries) |
Domain d1gpub3: 1gpu B:535-680 [65459] Other proteins in same PDB: d1gpua1, d1gpua2, d1gpub1, d1gpub2 |
PDB Entry: 1gpu (more details), 1.86 Å
SCOP Domain Sequences for d1gpub3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gpub3 c.48.1.1 (B:535-680) Transketolase, TK {Baker's yeast (Saccharomyces cerevisiae)} egssiesaskggyvlqdvanpdiilvatgsevslsveaaktlaaknikarvvslpdfftf dkqpleyrlsvlpdnvpimsvevlattcwgkyahqsfgidrfgasgkapevfkffgftpe gvaeraqktiafykgdklisplkkaf
Timeline for d1gpub3: