SCOP 1.69: Domain d1gpua2: 1gpu A:338-534

Lineage for d1gpua2 (1gpu A:338-534)

1. Root: SCOP 1.69

2. Class c: Alpha and beta proteins (a/b) [51349] (136 folds)

3. Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465

4. Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (8 families)
   there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules
   two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules

5. Family c.36.1.6: TK-like Pyr module [88735] (2 proteins)
   different order of the modules, PP module is N-terminal, Pyr module is next to it followed by a Rossmann-like domain

6. Protein Transketolase (TK), Pyr module [88736] (3 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [88737] (7 PDB entries)

8. Domain d1gpua2: 1gpu A:338-534 [65455]
   Other proteins in same PDB: d1gpua1, d1gpua3, d1gpub1, d1gpub3

Details for d1gpua2

PDB Entry: 1gpu, 1.86 Å

PDB Description: transketolase complex with reaction intermediate

SCOP Domain Sequences for d1gpua2:

Sequence; same for both SEQRES and ATOM records:

>d1gpua2 c.36.1.6 (A:338-534) Transketolase (TK), Pyr module {Baker's yeast (Saccharomyces cerevisiae)}
lpanwesklptytakdsavatrklsetvledvynqlpeliggsadltpsnltrwkealdf
qppssgsgnysgryirygirehamgaimngisafganykpyggtflnfvsyaagavrlsa
lsghpviwvathdsigvgedgpthqpietlahfrslpniqvwrpadgnevsaayknsles
khtpsiialsrqnlpql

Timeline for d1gpua2:

• d1gpua2 first appeared in SCOP 1.59
  
• d1gpua2 appears in SCOP 1.67
  
• d1gpua2 appears in SCOP 1.71
  
• d1gpua2 appears in the current release, SCOPe 2.08