Lineage for d1gozb2 (1goz B:2122-2238)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2538334Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2541472Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (2 families) (S)
  5. 2541473Family d.15.6.1: Superantigen toxins, C-terminal domain [54335] (16 proteins)
  6. 2541495Protein Staphylococcal enterotoxin B, SEB [54342] (1 species)
  7. 2541496Species Staphylococcus aureus [TaxId:1280] [54343] (18 PDB entries)
  8. 2541504Domain d1gozb2: 1goz B:2122-2238 [65438]
    Other proteins in same PDB: d1goza1, d1gozb1
    mutant

Details for d1gozb2

PDB Entry: 1goz (more details), 2 Å

PDB Description: structural basis for the altered t-cell receptor binding specificty in a superantigenic staphylococcus aureus enterotoxin-b mutant
PDB Compounds: (B:) enterotoxin type b

SCOPe Domain Sequences for d1gozb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gozb2 d.15.6.1 (B:2122-2238) Staphylococcal enterotoxin B, SEB {Staphylococcus aureus [TaxId: 1280]}
ngnqldkyrsitvrvfedgknllsfdvqtnkkkvtaqeldyltrhylvknkklyefnnsp
yetgyikfienensfwydmmpapgdkfdqskylmmyndnkmvdskdvkievylttkk

SCOPe Domain Coordinates for d1gozb2:

Click to download the PDB-style file with coordinates for d1gozb2.
(The format of our PDB-style files is described here.)

Timeline for d1gozb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1gozb1