SCOP 1.59: Domain d1gozb2: 1goz B:2122-2238

Lineage for d1gozb2 (1goz B:2122-2238)

1. Root: SCOP 1.59

2. Class d: Alpha and beta proteins (a+b) [53931] (208 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (9 superfamilies)

4. Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (1 family)

5. Family d.15.6.1: Superantigen toxins, C-terminal domain [54335] (11 proteins)

6. Protein Staphylococcal enterotoxin B, SEB [54342] (1 species)

7. Species Staphylococcus aureus [TaxId:1280] [54343] (11 PDB entries)

8. Domain d1gozb2: 1goz B:2122-2238 [65438]
   Other proteins in same PDB: d1goza1, d1gozb1

Details for d1gozb2

PDB Entry: 1goz, 2 Å

PDB Description: structural basis for the altered t-cell receptor binding specificty in a superantigenic staphylococcus aureus enterotoxin-b mutant

SCOP Domain Sequences for d1gozb2:

Sequence; same for both SEQRES and ATOM records:

>d1gozb2 d.15.6.1 (B:2122-2238) Staphylococcal enterotoxin B, SEB {Staphylococcus aureus}
ngnqldkyrsitvrvfedgknllsfdvqtnkkkvtaqeldyltrhylvknkklyefnnsp
yetgyikfienensfwydmmpapgdkfdqskylmmyndnkmvdskdvkievylttkk

Timeline for d1gozb2:

• d1gozb2 is new in SCOP 1.59
  
• d1gozb2 appears in SCOP 1.61
  
• d1gozb2 appears in the current release, SCOPe 2.08