SCOPe 2.01: Domain d1gozb1: 1goz B:2001-2121

Lineage for d1gozb1 (1goz B:2001-2121)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.40: OB-fold [50198] (16 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.2: Bacterial enterotoxins [50203] (2 families)

5. Family b.40.2.2: Superantigen toxins, N-terminal domain [50219] (15 proteins)

6. Protein Staphylococcal enterotoxin B, SEB [50226] (1 species)

7. Species Staphylococcus aureus [TaxId:1280] [50227] (12 PDB entries)

8. Domain d1gozb1: 1goz B:2001-2121 [65437]
   Other proteins in same PDB: d1goza2, d1gozb2
   mutant

Details for d1gozb1

PDB Entry: 1goz, 2 Å

PDB Description: structural basis for the altered t-cell receptor binding specificty in a superantigenic staphylococcus aureus enterotoxin-b mutant

PDB Compounds: (B:) enterotoxin type b

SCOPe Domain Sequences for d1gozb1:

Sequence, based on SEQRES records:

>d1gozb1 b.40.2.2 (B:2001-2121) Staphylococcal enterotoxin B, SEB {Staphylococcus aureus [TaxId: 1280]}
esqpdpkpdelhksskftglmenmkvlyddnhvsainvksidqflyfdliysikdtklgn
ydnvrvefknkdladkykdkyvdvfganyyyqcyfskktndinshqtdkrkscmyggvte
h

Sequence, based on observed residues (ATOM records):

>d1gozb1 b.40.2.2 (B:2001-2121) Staphylococcal enterotoxin B, SEB {Staphylococcus aureus [TaxId: 1280]}
esqpdpkpdelhksskftglmenmkvlyddnhvsainvksidqflyfdliysikdtklgn
ydnvrvefknkdladkykdkyvdvfganyyyqcyfskdkrkscmyggvteh

Timeline for d1gozb1:

• d1gozb1 first appeared in SCOP 1.59
  
• d1gozb1 appears in SCOP 1.75
  
• d1gozb1 appears in SCOPe 2.02
  
• d1gozb1 appears in the current release, SCOPe 2.08