SCOPe 2.07: Domain d1goza2: 1goz A:1122-1238

Lineage for d1goza2 (1goz A:1122-1238)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (2 families)

5. Family d.15.6.1: Superantigen toxins, C-terminal domain [54335] (16 proteins)

6. Protein Staphylococcal enterotoxin B, SEB [54342] (1 species)

7. Species Staphylococcus aureus [TaxId:1280] [54343] (18 PDB entries)

8. Domain d1goza2: 1goz A:1122-1238 [65436]
   Other proteins in same PDB: d1goza1, d1gozb1
   mutant

Details for d1goza2

PDB Entry: 1goz, 2 Å

PDB Description: structural basis for the altered t-cell receptor binding specificty in a superantigenic staphylococcus aureus enterotoxin-b mutant

PDB Compounds: (A:) enterotoxin type b

SCOPe Domain Sequences for d1goza2:

Sequence; same for both SEQRES and ATOM records:

>d1goza2 d.15.6.1 (A:1122-1238) Staphylococcal enterotoxin B, SEB {Staphylococcus aureus [TaxId: 1280]}
ngnqldkyrsitvrvfedgknllsfdvqtnkkkvtaqeldyltrhylvknkklyefnnsp
yetgyikfienensfwydmmpapgdkfdqskylmmyndnkmvdskdvkievylttkk

Timeline for d1goza2:

• d1goza2 first appeared in SCOP 1.59
  
• d1goza2 appears in SCOPe 2.06
  
• d1goza2 appears in the current release, SCOPe 2.08