Class d: Alpha and beta proteins (a+b) [53931] (234 folds) |
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (11 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (1 family) |
Family d.15.6.1: Superantigen toxins, C-terminal domain [54335] (12 proteins) |
Protein Staphylococcal enterotoxin B, SEB [54342] (1 species) |
Species Staphylococcus aureus [TaxId:1280] [54343] (13 PDB entries) |
Domain d1goza2: 1goz A:1122-1238 [65436] Other proteins in same PDB: d1goza1, d1gozb1 |
PDB Entry: 1goz (more details), 2 Å
SCOP Domain Sequences for d1goza2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1goza2 d.15.6.1 (A:1122-1238) Staphylococcal enterotoxin B, SEB {Staphylococcus aureus} ngnqldkyrsitvrvfedgknllsfdvqtnkkkvtaqeldyltrhylvknkklyefnnsp yetgyikfienensfwydmmpapgdkfdqskylmmyndnkmvdskdvkievylttkk
Timeline for d1goza2: