SCOP 1.63: Domain d1govb_: 1gov B:

Lineage for d1govb_ (1gov B:)

1. Root: SCOP 1.63

2. Class d: Alpha and beta proteins (a+b) [53931] (224 folds)

3. Fold d.1: Microbial ribonucleases [53932] (1 superfamily)
   single helix packs against antiparallel beta-sheet

4. Superfamily d.1.1: Microbial ribonucleases [53933] (3 families)

5. Family d.1.1.2: Bacterial ribonucleases [81307] (5 proteins)

6. Protein Binase [81306] (1 species)

7. Species Bacillus intermedius [TaxId:1400] [53946] (5 PDB entries)

8. Domain d1govb_: 1gov B: [65432]
   complexed with so4

Details for d1govb_

PDB Entry: 1gov, 2 Å

PDB Description: ribonuclease bi(g specific endonuclease) complexed with sulfate ions

SCOP Domain Sequences for d1govb_:

Sequence; same for both SEQRES and ATOM records:

>d1govb_ d.1.1.2 (B:) Binase {Bacillus intermedius}
vintfdgvadylirykrlpndyitksqasalgwvaskgdlaevapgksiggdvfsnregr
lpsagsrtwreadinyvsgfrnadrlvyssdwliykttdhyatftrir

Timeline for d1govb_:

• d1govb_ first appeared in SCOP 1.59
  
• d1govb_ appears in SCOP 1.61
  
• d1govb_ appears in SCOP 1.65
  
• d1govb_ appears in the current release, SCOPe 2.08