Lineage for d1gosa1 (1gos A:4-289,A:402-500)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1154265Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)
    core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meander
  4. 1154266Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (8 families) (S)
  5. 1154320Family c.3.1.2: FAD-linked reductases, N-terminal domain [51913] (18 proteins)
    C-terminal domain is alpha+beta is common for the family
  6. 1154412Protein Monoamine oxidase B [69423] (2 species)
  7. 1154413Species Human (Homo sapiens) [TaxId:9606] [69424] (28 PDB entries)
  8. 1154466Domain d1gosa1: 1gos A:4-289,A:402-500 [65425]
    Other proteins in same PDB: d1gosa2, d1gosb2
    complexed with fad, nyp

Details for d1gosa1

PDB Entry: 1gos (more details), 3 Å

PDB Description: human monoamine oxidase b
PDB Compounds: (A:) monoamine oxidase

SCOPe Domain Sequences for d1gosa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gosa1 c.3.1.2 (A:4-289,A:402-500) Monoamine oxidase B {Human (Homo sapiens) [TaxId: 9606]}
kcdvvvvgggisgmaaakllhdsglnvvvleardrvggrtytlrnqkvkyvdlggsyvgp
tqnrilrlakelgletykvneverlihhvkgksypfrgpfppvwnpityldhnnfwrtmd
dmgreipsdapwkaplaeewdnmtmkelldklcwtesakqlatlfvnlcvtaethevsal
wflwyvkqcggttriisttnggqerkfvggsgqvserimdllgdrvklerpviyidqtre
nvlvetlnhemyeakyvisaipptlgmkihfnpplpmmrnqmitrvXfppgiltqygrvl
rqpvdriyfagtetathwsgymegaveageraareilhamgkipedeiwqsepesvdvpa
qpitttflerhlpsvpgllrligltt

SCOPe Domain Coordinates for d1gosa1:

Click to download the PDB-style file with coordinates for d1gosa1.
(The format of our PDB-style files is described here.)

Timeline for d1gosa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1gosa2