Lineage for d1goka_ (1gok A:)
- Root: SCOP 1.59
Class c: Alpha and beta proteins (a/b) [51349] (113 folds) 
Fold c.1: TIM beta/alpha-barrel [51350] (24 superfamilies) Superfamily c.1.8: (Trans)glycosidases [51445] (9 families) 
Family c.1.8.3: beta-glycanases [51487] (13 proteins) 
Protein Xylanase A, catalytic core [51514] (6 species) Species Thermoascus aurantiacus [TaxId:5087] [51518] (9 PDB entries) 
Domain d1goka_: 1gok A: [65420]
Details for d1goka_
PDB Entry: 1gok (more details), 1.14 Å
PDB Description: thermostable xylanase i from thermoascus aurantiacus- crystal form ii
SCOP Domain Sequences for d1goka_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1goka_ c.1.8.3 (A:) Xylanase A, catalytic core {Thermoascus aurantiacus}
eaaqsvdqlikargkvyfgvatdqnrlttgknaaiiqadfgqvtpensmkwdatepsqgn
fnfagadylvnwaqqngklirghtlvwhsqlpswvssitdkntltnvmknhittlmtryk
gkirawdvvneafnedgslrqtvflnvigedyipiafqtaraadpnaklyindynldsas
ypktqaivnrvkqwraagvpidgigsqthlsagqgagvlqalpllasagtpevaiteldv
agasptdyvnvvnaclnvqscvgitvwgvadpdswrasttpllfdgnfnpkpaynaivqd
lqq
SCOP Domain Coordinates for d1goka_:
Click to download the PDB-style file with coordinates for d1goka_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1goka_:
- d1goka_ is new in SCOP 1.59
- d1goka_ appears in SCOP 1.61
- d1goka_ appears in the current release, SCOPe 2.08
View in 3D