Lineage for d1go3e_ (1go3 E:)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 228551Fold b.40: OB-fold [50198] (9 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 229103Superfamily b.40.4: Nucleic acid-binding proteins [50249] (10 families) (S)
  5. 229270Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (16 proteins)
    barrel, closed; n=5, S=8
  6. 229370Protein RNA polymerase II subunit RBP4 (RpoE) [69268] (1 species)
    includes the N-terminal heterodimerisation alpha+beta subdomain
  7. 229371Species Archaeon Methanococcus jannaschii [TaxId:2190] [69269] (1 PDB entry)
  8. 229372Domain d1go3e_: 1go3 E: [65406]
    Other proteins in same PDB: d1go3f_, d1go3n_

Details for d1go3e_

PDB Entry: 1go3 (more details), 1.75 Å

PDB Description: structure of an archeal homolog of the eukaryotic rna polymerase ii rpb4/rpb7 complex

SCOP Domain Sequences for d1go3e_:

Sequence, based on SEQRES records: (download)

>d1go3e_ b.40.4.5 (E:) RNA polymerase II subunit RBP4 (RpoE) {Archaeon Methanococcus jannaschii}
mykileiadvvkvppeefgkdlketvkkilmekyegrldkdvgfvlsivdvkdigegkvv
hgdgsayhpvvfetlvyipemyeliegevvdvvefgsfvrlgpldglihvsqimddyvsy
dpkreaiigketgkvleigdyvrarivaislkaerkrgskialtmrqpylgklewieeek
akkq

Sequence, based on observed residues (ATOM records): (download)

>d1go3e_ b.40.4.5 (E:) RNA polymerase II subunit RBP4 (RpoE) {Archaeon Methanococcus jannaschii}
mykileiadvvkvppeefgkdlketvkkilmekyegrldkdvgfvlsivdvkdigegkvv
hgdgsayhpvvfetlvyipemyeliegevvdvvefgsfvrlgpldglihvsqimddyvsy
dpkaiigketgkvleigdyvrarivaislkaskialtmrqpylgklewieeekakkq

SCOP Domain Coordinates for d1go3e_:

Click to download the PDB-style file with coordinates for d1go3e_.
(The format of our PDB-style files is described here.)

Timeline for d1go3e_: